PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P08840_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 317aa    MW: 35134.5 Da    PI: 7.1793
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P08840_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.5e-101421791954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  GSMUA_Achr5P08840_001 142 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 179
                            664459******************************88 PP

2BELL96.81.9e-3119731872
                   BELL 18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                            Vd+rY++y++q+q+v++sF+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  GSMUA_Achr5P08840_001 19 GVDRRYNHYCDQMQMVVNSFDSVMGFGAAAPYTALAQKAMSRHFRCLKDAIATQL 73
                           59**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.0E-7371IPR006563POX domain
PfamPF075263.5E-281970IPR006563POX domain
PROSITE profilePS5007112.6120183IPR001356Homeobox domain
CDDcd000862.56E-13123184No hitNo description
SMARTSM003894.0E-9123187IPR001356Homeobox domain
SuperFamilySSF466891.71E-17124190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-29126189IPR009057Homeodomain-like
PfamPF059201.2E-18140179IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MCCEWLMALE KEKKIIVLGV DRRYNHYCDQ MQMVVNSFDS VMGFGAAAPY TALAQKAMSR  60
HFRCLKDAIA TQLKQTCELL GDKEGASGSG ITKGETPRLR FIDQNLRQQR AFHQMGMMEQ  120
EAWRPQRGLP ERSVNILRSW LFEHFLHPYP SDADKHLLAR QTGLSRNQVS NWFINARVRL  180
WKPMVEDMYQ QEFKEEGEES EKGEANAPAE GDPSASSSSM SRQHHFVSSS ETLPPGVAFS  240
HHGHSSGGSD DNVLIMPHVP TSDVYRFGTT AGAASSLGAP APARFGTTGD VSLTLGLRHA  300
GGNPSEKSQF SVRDFGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-17129186158Homeobox protein Meis1
4xrs_B2e-17129186158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400050.10.0PREDICTED: BEL1-like homeodomain protein 4 isoform X1
SwissprotQ94KL51e-123BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0SWW30.0M0SWW3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P08840_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-111BEL1-like homeodomain 2